DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and tmprss4b

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001119849.1 Gene:tmprss4b / 327651 ZFINID:ZDB-GENE-030131-5862 Length:432 Species:Danio rerio


Alignment Length:291 Identity:108/291 - (37%)
Similarity:154/291 - (52%) Gaps:28/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ATLSSSSMMPDAASTTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSDC--VCGIANIQKRIVG 129
            ||:|:.|...|..|..|.:....|.|..:.               :||||  |.|    :.||||
Zfish   159 ATVSNDSAQSDIQSFLSASNKCSSGSVVSV---------------SCSDCGEVVG----EDRIVG 204

  Fly   130 GQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKMSHMQKI 194
            |.||.:..:||...|.:..|..|..|||:..::::|:||..|..:|.....::....|:  |..:
Zfish   205 GVETSIEHWPWQVSLQFNHRHMCGGSLLSTSWIISAAHCFTGRTQELSRWTVVLGQTKV--MDVV 267

  Fly   195 DRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWGALKVG 259
            ...|..::.|..||....|.|||::||..||:..|.:.|||:|....:.| :..:|||||.||.|
Zfish   268 GVSVDMIVIHKDYNRLTNDFDIAMLKLTWPVKTGESILPVCLPPHQLAIK-DMLVVTGWGLLKEG 331

  Fly   260 GPTSDTLQEVQVPILSQDECRK-SRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREH 323
            |.....||:..||::::.||.| :.|.:.||..|||.|:.:|..|:|||||||||..::|   ..
Zfish   332 GALPTVLQKASVPLVNRSECSKPTIYSSSITPRMLCAGFLQGNVDACQGDSGGPLVYLSS---RW 393

  Fly   324 QIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            |:.|:||||.|||:.|.|||||.|.:...||
Zfish   394 QLIGIVSWGVGCAREGKPGVYADVTQLLDWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 91/228 (40%)
Tryp_SPc 127..356 CDD:238113 92/229 (40%)
tmprss4bNP_001119849.1 SRCR_2 100..179 CDD:292133 7/19 (37%)
SRCR 105..>175 CDD:278931 6/15 (40%)
Tryp_SPc 201..424 CDD:214473 91/228 (40%)
Tryp_SPc 202..427 CDD:238113 92/229 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6379
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.