DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG4653

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:233 Identity:60/233 - (25%)
Similarity:109/233 - (46%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCV--------YGFRKERISVRLLEHDRKMSH 190
            ||...|....|...|...|..:|:.::::|||:|||        |..:...:.|..::   :::.
  Fly    32 EVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQ---RLTG 93

  Fly   191 MQKIDRKVAEVITHPKYNARNY--DNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGW 253
            .|.:  .::::|.|..|::.:.  .||:|:::|:..|..|...:|:.:.|. |...|...|.:||
  Fly    94 GQLV--PLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATE-RPAAGSQIIFSGW 155

  Fly   254 GALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLC-GGYDEGGKDSCQGDSGGPLHIVA 317
            |:.:|.|..|..||......||..:|:...|..:  :::|| ...||.....|.||:|.|     
  Fly   156 GSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQ--EDLLCLSPVDEDFAGLCSGDAGAP----- 213

  Fly   318 SGTREHQIAGVVS-WGEGCAKAGYPGVYARVNRYGTWI 354
             .:..:|:.|:.: :..||. :..|..|..|.::..||
  Fly   214 -ASYNNQLVGIAAFFVSGCG-SEQPDGYVDVTQHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 58/231 (25%)
Tryp_SPc 127..356 CDD:238113 60/233 (26%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 60/233 (26%)
Tryp_SPc 30..249 CDD:214473 58/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.