DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and HPR

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_024306019.1 Gene:HPR / 3250 HGNCID:5156 Length:354 Species:Homo sapiens


Alignment Length:266 Identity:73/266 - (27%)
Similarity:127/266 - (47%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DCVCG----IANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKE 175
            :.|||    .||..:||:||.......:||.|.::........|:|:|:|:|||.:..::....|
Human    94 EAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSE 158

  Fly   176 RISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPG 240
            ..:.:.:.....:...:|...::.:|:.||.|    :..||.:|||.:.|..||.:.|:|:|:..
Human   159 NATAKDIAPTLTLYVGKKQLVEIEKVVLHPNY----HQVDIGLIKLKQKVLVNERVMPICLPSKN 219

  Fly   241 RSFKGENGIVTGWGA---LKVGGPTSDTLQEVQVPILSQDEC--------------RKSRYGNK- 287
            .:..|..|.|:|||.   .|:    :|.|:.|.:|:..|.:|              .||..|.: 
Human   220 YAEVGRVGYVSGWGQSDNFKL----TDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQP 280

  Fly   288 -ITDNMLCGGYDEGGKDSCQGDSGG--PLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNR 349
             :.::..|.|..:..:|:|.||:|.  .:|.:...|  ...||::|:.:.||.|.| |||.:|..
Human   281 ILNEHTFCVGMSKYQEDTCYGDAGSAFAVHDLEEDT--WYAAGILSFDKSCAVAEY-GVYVKVTS 342

  Fly   350 YGTWIK 355
            ...|::
Human   343 IQHWVQ 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 67/248 (27%)
Tryp_SPc 127..356 CDD:238113 67/250 (27%)
HPRXP_024306019.1 Tryp_SPc 110..350 CDD:238113 67/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.