DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and HPN

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:265 Identity:99/265 - (37%)
Similarity:136/265 - (51%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CSDCVCGIANIQ-KRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKER 176
            |.|  ||...:. .|||||::|.:.::||...|.|.|...|..|||:..::|||:||        
Human   150 CQD--CGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHC-------- 204

  Fly   177 ISVRLLEHDRKMSHMQKIDRKVAE------------VITHPKY------NARNYDNDIAIIKLDE 223
                ..|.:|.:|..:.....||:            |:.|..|      |:....||||::.|..
Human   205 ----FPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSS 265

  Fly   224 PVEFNEVLHPVCMPTPGRSF-KGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSR-YGN 286
            |:...|.:.|||:|..|::. .|:...|||||..:..|..:..|||.:|||:|.|.|..:. |||
Human   266 PLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGN 330

  Fly   287 KITDNMLCGGYDEGGKDSCQGDSGGPL--HIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNR 349
            :|...|.|.||.|||.|:||||||||.  ....|.|...::.|:||||.|||.|..||||.:|:.
Human   331 QIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSD 395

  Fly   350 YGTWI 354
            :..||
Human   396 FREWI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 93/249 (37%)
Tryp_SPc 127..356 CDD:238113 94/250 (38%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275 4/10 (40%)
Tryp_SPc 163..400 CDD:238113 92/248 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8579
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.