DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and HP

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_005134.1 Gene:HP / 3240 HGNCID:5141 Length:406 Species:Homo sapiens


Alignment Length:263 Identity:70/263 - (26%)
Similarity:124/263 - (47%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DCVCG----IANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKE 175
            :.|||    .||..:||:||.......:||.|.::........|:|:|:|:|||.:..::....|
Human   146 EAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSE 210

  Fly   176 RISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPG 240
            ..:.:.:.....:...:|...::.:|:.||.|:    ..||.:|||.:.|..||.:.|:|:|:..
Human   211 NATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYS----QVDIGLIKLKQKVSVNERVMPICLPSKD 271

  Fly   241 RSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKI----------------T 289
            .:..|..|.|:|||. ......:|.|:.|.:|:..||:|.:...|:.:                .
Human   272 YAEVGRVGYVSGWGR-NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILN 335

  Fly   290 DNMLCGGYDEGGKDSCQGDSGG--PLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGT 352
            ::..|.|..:..:|:|.||:|.  .:|.:...|  ....|::|:.:.||.|.| |||.:|.....
Human   336 EHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDT--WYATGILSFDKSCAVAEY-GVYVKVTSIQD 397

  Fly   353 WIK 355
            |::
Human   398 WVQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 64/245 (26%)
Tryp_SPc 127..356 CDD:238113 64/247 (26%)
HPNP_005134.1 CCP 33..87 CDD:153056
CCP 92..146 CDD:153056 70/263 (27%)
Tryp_SPc 161..399 CDD:214473 64/245 (26%)
Tryp_SPc 162..402 CDD:238113 64/247 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.