DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG31827

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:263 Identity:72/263 - (27%)
Similarity:122/263 - (46%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 CGIAN-----IQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERI 177
            ||..|     :|..:..|| .:..::||...:::........||:....:|||:|.::....|.|
  Fly    31 CGYGNPDAVKVQFNVTEGQ-AKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDI 94

  Fly   178 SVRLLEHDRKMSHMQKI---DRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTP 239
            .|...|.:.. |.::|.   :..|.:::.|..:|.:...|::|::.||........::.:|:||.
  Fly    95 VVSAGEWEYG-SALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQ 158

  Fly   240 GRSFKGENGIVTGWGALKVGGPTSDT-----LQEVQVPI----LSQDECRKSRYGNKIT--DNML 293
            .||......||.|||..:.    |||     |:::.:||    :.||:.||:|.|...|  ..::
  Fly   159 KRSLSSTRCIVAGWGKYQF----SDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLI 219

  Fly   294 CGGYDEGGKDSCQGDSGGPLHI-VASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNL 357
            |.| .|...|:|.||.||.|.. :....::.:..|:|:||.||.:...|..|..|..:..||...
  Fly   220 CAG-GEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQ 283

  Fly   358 TKQ 360
            .|:
  Fly   284 IKE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 65/242 (27%)
Tryp_SPc 127..356 CDD:238113 67/243 (28%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 65/238 (27%)
Tryp_SPc 50..280 CDD:214473 63/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.