DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG32523

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:257 Identity:73/257 - (28%)
Similarity:122/257 - (47%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VCGI--------------ANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASH 167
            :||:              :.|:.|||||.:.:..|:|....|...|..||...:::...::||.|
  Fly    13 LCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGH 77

  Fly   168 CV-YGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVL 231
            || :|.......:..::....:.....:...|||||.||.| |....||:|:::|..|:.|:..:
  Fly    78 CVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANI 141

  Fly   232 HPVCMPT--PGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLC 294
            ..:.:.|  |......:   ::|||.:...||.||:|..|||..:|:..||...| :::.:.|:|
  Fly   142 AAIQLATEDPPNCVAVD---ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY-SRLPETMIC 202

  Fly   295 GGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVS--WGEGCAKAGYPGVYARVNRYGTWI 354
            ..:.: ...:|.||||||      .|...::.|:.|  .|.||.:|. |..|.|:::...||
  Fly   203 LLHSK-NSGACYGDSGGP------ATYGGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 68/232 (29%)
Tryp_SPc 127..356 CDD:238113 69/233 (30%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/232 (29%)
Tryp_SPc 37..219 CDD:238113 55/187 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.