DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG32376

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:236 Identity:79/236 - (33%)
Similarity:120/236 - (50%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRL-LEHDRKMS 189
            |||.|:.....:.|:...|.|.|.|.|...::|..::|||.||.:| ..|:.:||: .:..|:..
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFG-PPEKYTVRVGSDQQRRGG 128

  Fly   190 HMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWG 254
            .:    |.|.:::....||.....:|:|::||..||.|.:.:.||.:|:...:...:..:|:|||
  Fly   129 QL----RHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVSGWG 189

  Fly   255 ALKVGGPTSDT-LQEVQVPILSQDECRK--SRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIV 316
            ........... |:.||:..:.:.:|:|  .:.|.||..:|:|.  ....||||.|||||||   
  Fly   190 ITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICA--SRTNKDSCSGDSGGPL--- 249

  Fly   317 ASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNL 357
               |....:.|:||||.|||...|||||....||..|||.:
  Fly   250 ---TSRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWIKKV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 76/231 (33%)
Tryp_SPc 127..356 CDD:238113 77/232 (33%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 76/231 (33%)
Tryp_SPc 66..287 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.