DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tmprss3

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:251 Identity:95/251 - (37%)
Similarity:135/251 - (53%) Gaps:19/251 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CSDCVCGI-ANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGF---R 173
            ||  .||: .....|||||..:.:.|:||...|.:.|...|..|::...:::||:||||..   :
  Rat   204 CS--ACGMRTGYSPRIVGGNVSSLTQWPWQVSLQFQGYHLCGGSVITPLWIVTAAHCVYDLYHPK 266

  Fly   174 KERISVRL--LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCM 236
            ...:.|.|  |......||:      |.::|.|.||..:...||||::||.||:.|:|.:.|:|:
  Rat   267 SWTVQVGLVSLMDSPVPSHL------VEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICL 325

  Fly   237 PTPGRSF-KGENGIVTGWGALKVG-GPTSDTLQEVQVPILSQDEC-RKSRYGNKITDNMLCGGYD 298
            |....:| .|:....:||||.:.| |..|..|....||::|...| .:..||..|:.:|||.||.
  Rat   326 PNSEENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYL 390

  Fly   299 EGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            :||.|||||||||||  |....|..::.|..|:|.|||:...||||.|:..:..||
  Rat   391 KGGVDSCQGDSGGPL--VCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 89/235 (38%)
Tryp_SPc 127..356 CDD:238113 90/236 (38%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 4/8 (50%)
Tryp_SPc 216..444 CDD:214473 89/235 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.