DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tpsb2

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:253 Identity:92/253 - (36%)
Similarity:125/253 - (49%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 IVGGQETEVHQYPWVAMLLYGGRF---YCAASLLNDQFLLTASHCVYGFR---KERISVRLLEHD 185
            ||||:|....::||...|.:...|   :|..||::.|::|||:||| |..   .|...|:|.|  
  Rat    30 IVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCV-GLHIKSPELFRVQLRE-- 91

  Fly   186 RKMSHMQKIDR--KVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF-KGEN 247
               .::...|:  .|...:.||.|.......|||:::|:.||..:..:||..:|....:| .|.:
  Rat    92 ---QYLYYADQLLTVNRTVVHPHYYTVEDGADIALLELENPVNVSTHIHPTSLPPASETFPSGTS 153

  Fly   248 GIVTGWGALKVGGPTSD--TLQEVQVPILSQDECRKSRYGNKIT--------DNMLCGGYDEGGK 302
            ..|||||.:....|...  .|::|:|||:....|.:..:....|        |.|||.|...  .
  Rat   154 CWVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLCAGNTR--S 216

  Fly   303 DSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQ 360
            |||||||||||.....||...  |||||||||||:|..||:|.||..|..||.....|
  Rat   217 DSCQGDSGGPLVCKVKGTWLQ--AGVVSWGEGCAEANRPGIYTRVTYYLDWIHRYVPQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 89/245 (36%)
Tryp_SPc 127..356 CDD:238113 91/247 (37%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 91/247 (37%)
Tryp_SPc 30..266 CDD:214473 89/245 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.