DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Hpn

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus


Alignment Length:265 Identity:98/265 - (36%)
Similarity:131/265 - (49%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CSDCVCGIANIQ-KRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKER 176
            |.|  ||...:. .||||||::.:.::||...|.|.|...|..|||:..::|||:||        
  Rat   191 CQD--CGRRKLPVDRIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAHC-------- 245

  Fly   177 ISVRLLEHDRKMSHMQKIDRKVAE------------VITHPKY------NARNYDNDIAIIKLDE 223
                ..|.:|.:|..:.....||.            ||.|..|      ......||||::.|..
  Rat   246 ----FPERNRVLSRWRVFAGAVARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSS 306

  Fly   224 PVEFNEVLHPVCMPTPGRSF-KGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRK-SRYGN 286
            .:...|.:.|||:|..|::. .|:...|||||..:..|..:..|||.:|||:|.:.|.. ..|||
  Rat   307 SLPLTEYIQPVCLPAAGQALVDGKVCTVTGWGNTQFYGQQAVVLQEARVPIISNEVCNSPDFYGN 371

  Fly   287 KITDNMLCGGYDEGGKDSCQGDSGGPL--HIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNR 349
            :|...|.|.||.|||.|:||||||||.  ....|||...::.|:||||.|||.|..||||.:|..
  Rat   372 QIKPKMFCAGYPEGGIDACQGDSGGPFVCEDRISGTSRWRLCGIVSWGTGCALARKPGVYTKVID 436

  Fly   350 YGTWI 354
            :..||
  Rat   437 FREWI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 92/249 (37%)
Tryp_SPc 127..356 CDD:238113 93/250 (37%)
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275 4/10 (40%)
Tryp_SPc 204..441 CDD:238113 91/248 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12330
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.