DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tmprss11g

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001008554.1 Gene:Tmprss11g / 289546 RGDID:1306446 Length:417 Species:Rattus norvegicus


Alignment Length:371 Identity:116/371 - (31%)
Similarity:180/371 - (48%) Gaps:42/371 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSQSASQDRATNQTAASPLLKQSQNTFIQWVL------------SLLPQRPGSSDSENA------ 64
            ||...|.|.:..|:.....|||..|..|..:.            .::..|| |:|...|      
  Rat    57 PSIKYSSDLSEEQSKLQINLKQKINNEIDVIFQRSSLKHHYVKSQVVNFRP-SNDGVKADILIKF 120

  Fly    65 TLATLSSSSMMPDAASTTSTTTPAPSSSTTTTRRATTP---------APPTLNPPRNCSDCVCGI 120
            .:...::.::..:|.|..:  ....||.:...|..:.|         |...||     |:|..|:
  Rat   121 QIPRKNADTLRSEADSILN--KKLQSSQSFLKRDISLPYLREMNAAQAEHILN-----SNCGLGM 178

  Fly   121 ANIQ-KRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEH 184
            ...: .||..|:....:.:||.:.|...|...|.|||:..|:|:|::||...::..::..  :..
  Rat   179 EYPRIARIADGKPAGSNSWPWQSSLQVEGIHLCGASLIGSQWLVTSAHCFDNYKNPKLWT--VSF 241

  Fly   185 DRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGI 249
            .|.:.: ....|||..:|.|..|.|..:|:|||::||..||.|:|.|..||:|........::.:
  Rat   242 GRTLGN-PLTTRKVESIIIHENYAAHKHDDDIAVVKLSSPVLFSENLRTVCLPEATFQVLPKSKV 305

  Fly   250 -VTGWGALKVGGPTSDTLQEVQVPILSQDECRK-SRYGNKITDNMLCGGYDEGGKDSCQGDSGGP 312
             ||||||||..||..::||||::.|:|.|.|.: :.||..|:..|:|.|:..|..|:|:||||||
  Rat   306 FVTGWGALKANGPFPNSLQEVEIEIISNDVCNQVNVYGGAISSGMICAGFLTGKLDACEGDSGGP 370

  Fly   313 LHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLT 358
            | :::....:..:.|:||||..|.|...||:|.||..|..|||:.|
  Rat   371 L-VISDNRNKWYLLGIVSWGIDCGKENKPGIYTRVTHYRNWIKSKT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 85/229 (37%)
Tryp_SPc 127..356 CDD:238113 86/230 (37%)
Tmprss11gNP_001008554.1 SEA 48..142 CDD:279699 17/87 (20%)
Tryp_SPc 185..411 CDD:214473 85/229 (37%)
Tryp_SPc 186..414 CDD:238113 87/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.