DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss29

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:248 Identity:85/248 - (34%)
Similarity:128/248 - (51%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 IVGGQETEVHQYPW-VAMLLYGGRF-------YCAASLLNDQFLLTASHCVYGFRKERISVRLLE 183
            ||||......::|| |::.:|  |:       .|..|:::.|::|||:||::....:..:.|:..
  Rat    31 IVGGNSAPQGKWPWQVSLRVY--RYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYL 93

  Fly   184 HDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCM-PTPGRSFKGEN 247
            ....:...:|: .||:.||.||.:......:|:|:::|.:.|.....:.||.: |......|.:.
  Rat    94 GQVYLYGGEKL-LKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLEVTKKDV 157

  Fly   248 GIVTGWGALKV--GGPTSDTLQEVQVPILSQDECRK--------SRYGNK-ITDNMLCGGYDEGG 301
            ..|||||::.:  ..|....||:|||.|:....|.|        |.:|.: |..:|||.|  ..|
  Rat   158 CWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDMLCAG--SHG 220

  Fly   302 KDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            :|||.|||||||  |.:.|....:.||||||.|||....|||||||..:..||
  Rat   221 RDSCYGDSGGPL--VCNVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 83/246 (34%)
Tryp_SPc 127..356 CDD:238113 85/248 (34%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.