DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss30

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:255 Identity:88/255 - (34%)
Similarity:133/255 - (52%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPW-VAMLLYGGRFYCAASLLNDQFLLTASHC--------VYGFRKERISVRL 181
            :|||||:....::|| |::........|..||:::.::|||:||        .|..:...:::.|
  Rat    30 KIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTLSL 94

  Fly   182 LE-HDRKMSHMQKIDRKVAEVITHPKYNARNYDN-DIAIIKLDEPVEFNEVLHPVCMP------T 238
            .| |...::        |..:..:|.|...:..: |||:::||.|::.:: ..|||:|      |
  Rat    95 TEPHSTLVA--------VRNIFVYPTYLWEDASSGDIALLRLDTPLQPSQ-FSPVCLPQAQAPLT 150

  Fly   239 PGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRK-------SRYGNK-ITDNMLCG 295
            ||...     .||||||.. ....:..|||:.||:|..::|.:       |..|.: |..:|||.
  Rat   151 PGTVC-----WVTGWGATH-ERELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCA 209

  Fly   296 GYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIK 355
            |:.||.|||||||||||| :.|..:...|: |:.|||.|||:...||||.||..|..||:
  Rat   210 GFVEGQKDSCQGDSGGPL-VCAINSSWIQV-GITSWGIGCARPNKPGVYTRVPDYVDWIQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 86/252 (34%)
Tryp_SPc 127..356 CDD:238113 88/254 (35%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.