DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss3b

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:233 Identity:104/233 - (44%)
Similarity:134/233 - (57%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEH--DRKM 188
            :||||...:.:..|: .:.|..|..:|..||:|.|::::|:||.    |.||.|||.||  |...
  Rat    24 KIVGGYTCQKNSLPY-QVSLNAGYHFCGGSLINSQWVVSAAHCY----KSRIQVRLGEHNIDVVE 83

  Fly   189 SHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGW 253
            ...|.||  .|::|.||.|||..:||||.:|||:.|...|..:..|.:|....| .|...:|:||
  Rat    84 GGEQFID--AAKIIRHPSYNANTFDNDIMLIKLNSPATLNSRVSTVSLPRSCGS-SGTKCLVSGW 145

  Fly   254 G-ALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVA 317
            | .|..|......||.:..|:||...| ||.|..|||.||.|.|:.||||||||||||||  :|.
  Rat   146 GNTLSSGTNYPSLLQCLDAPVLSDSSC-KSSYPGKITSNMFCLGFLEGGKDSCQGDSGGP--VVC 207

  Fly   318 SGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIK 355
            :|    |:.||||||.|||:.|.||||.:|..|..||:
  Rat   208 NG----QLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 102/230 (44%)
Tryp_SPc 127..356 CDD:238113 104/232 (45%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 102/230 (44%)
Tryp_SPc 25..243 CDD:238113 104/232 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.