DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and f7i

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_775335.1 Gene:f7i / 282671 ZFINID:ZDB-GENE-021206-10 Length:443 Species:Danio rerio


Alignment Length:289 Identity:91/289 - (31%)
Similarity:135/289 - (46%) Gaps:49/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RNCS------------DCV------CGIANIQK-----RIVGGQETEVHQYPWVAMLLYGGRFYC 152
            |:||            .||      ||...:||     :.:||........||..::.|.|...|
Zfish   147 RSCSCAEGYALADDGTSCVSQVDYPCGKIPVQKNTSQNQFLGGIHCPRGHCPWQVLIDYNGESVC 211

  Fly   153 AASLLNDQFLLTASHCVYGFRKERISVRLL--EHDRKMSHMQKIDRKVAEVITHPKYNARNYDND 215
            ..:||...:|:||:|||:  :|:...::.:  |||..:....:...:|:.|..||.|:....|:|
Zfish   212 GGALLEGPWLITAAHCVH--QKDTRFLKAVTGEHDLDVLDGSEEPYEVSAVFIHPNYDPETLDSD 274

  Fly   216 IAIIKLDEPVEFNEVLHPVCMPTP--GRS--FKGENGIVTGWGALKVG----------GPTSDTL 266
            :|:::|..||:.:....|:|:|||  .||  :......::|||....|          ||.|.||
Zfish   275 LALLRLRVPVQRSLYAVPICLPTPQLARSELWAARFHTLSGWGTRTAGHNLRREKGLKGPASGTL 339

  Fly   267 QEVQVPILSQDECRKSRYGN-KITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVS 330
            |.:.||:|...:|     || ..|.||.|.||.||...||:|..|.|| :...|.... :.||||
Zfish   340 QRLAVPLLPAAQC-----GNANTTANMFCAGYTEGDHASCRGHDGSPL-VTRYGETSF-LTGVVS 397

  Fly   331 WGEGCAKAGYPGVYARVNRYGTWIKNLTK 359
            ||.||...||..:|.:|..:..|:..:.|
Zfish   398 WGRGCGPPGYYWIYTKVENFLIWMDTVMK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 80/244 (33%)
Tryp_SPc 127..356 CDD:238113 81/245 (33%)
f7iNP_775335.1 GLA 20..82 CDD:214503
EGF_CA <91..120 CDD:238011
FXa_inhibition 129..164 CDD:291342 3/16 (19%)
Tryp_SPc 188..420 CDD:214473 80/240 (33%)
Tryp_SPc 188..420 CDD:238113 80/240 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.