DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tpsg1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:325 Identity:102/325 - (31%)
Similarity:139/325 - (42%) Gaps:58/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QRPGSSDSEN--ATLATLSSSSMMPDAASTTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSDC 116
            |.||.::|..  .:..|:|:....||:.:.:.:                             |..
Mouse    38 QGPGLAESFQWATSKPTVSARGQYPDSLANSVS-----------------------------SGS 73

  Fly   117 VCG---IANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYG-FRKERI 177
            .||   ::|...|||||.......:||.|.|.......|..|||:.:::|||:||..| ......
Mouse    74 GCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDY 138

  Fly   178 SVRLLEHDRKMS-HMQKIDRKVAEVITHPKYNAR----NYDNDIAIIKLDEPVEFNEVLHPVCMP 237
            .|.|.|....:| |...:.|.:       .|...    ....|||:::|..||..:..:.|||:|
Mouse   139 QVHLGELTVTLSPHFSTVKRII-------MYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLP 196

  Fly   238 TPGRSF-KGENGIVTGWGALKVGGPTSD--TLQEVQVPILSQDECRK---SRYGNKITDNMLCGG 296
            .....| .|....|||||....|.|...  .|||.:|.::....|.:   |..|:.|..:|||. 
Mouse   197 EASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCA- 260

  Fly   297 YDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQA 361
              .|..|:||.||||||....:||  .|.||||||||||.:...|||||||..|..||.:...:|
Mouse   261 --RGPGDACQDDSGGPLVCQVAGT--WQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHIPEA 321

  Fly   362  361
            Mouse   322  321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 87/239 (36%)
Tryp_SPc 127..356 CDD:238113 88/240 (37%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 88/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.