DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and TPSG1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:263 Identity:93/263 - (35%)
Similarity:129/263 - (49%) Gaps:25/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NPPRNCS--DCVCG---IANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASH 167
            :||...|  |..||   :::...|||||.......:||.|.|.......|..|||:.|::|||:|
Human    39 SPPGTPSSFDLGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAH 103

  Fly   168 CVYG-FRKERISVRLLEHDRKMS-HMQKIDRKVAEVITHPKYNAR-NYDNDIAIIKLDEPVEFNE 229
            |..| .......|.|.|.:..:| |..    .|.::|.|...:.: ....|||:::|..||..:.
Human   104 CFSGSLNSSDYQVHLGELEITLSPHFS----TVRQIILHSSPSGQPGTSGDIALVELSVPVTLSS 164

  Fly   230 VLHPVCMPTPGRSF-KGENGIVTGWGALKVGGPTSD--TLQEVQVPILSQDECRKSRY----GNK 287
            .:.|||:|.....| .|....|||||..:.|.|...  :|:||:|.::..:.||:. |    |:.
Human   165 RILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRD-YPGPGGSI 228

  Fly   288 ITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGT 352
            :..:|||.   .|..|:||.||||||....:|....  ||.|||||||.:...||||.||..|..
Human   229 LQPDMLCA---RGPGDACQDDSGGPLVCQVNGAWVQ--AGTVSWGEGCGRPNRPGVYTRVPAYVN 288

  Fly   353 WIK 355
            ||:
Human   289 WIR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 85/237 (36%)
Tryp_SPc 127..356 CDD:238113 86/239 (36%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 85/237 (36%)
Tryp_SPc 63..293 CDD:238113 86/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.