DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG30289

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:268 Identity:82/268 - (30%)
Similarity:122/268 - (45%) Gaps:53/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 CGIAN---IQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISV 179
            |||:.   ....|.||.:|.:.:.||  |:|......|..||:..||:|||:||| .|  |.:.|
  Fly    30 CGISKDDPYVPNIFGGAKTNIQENPW--MVLVWSSKPCGGSLIARQFVLTAAHCV-SF--EDLYV 89

  Fly   180 RLLEHDR--------------KMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEV 230
            ||.:::.              |..:: .:|.|    |.|..||.....||||::::.|.||:::.
  Fly    90 RLGDYETLDPMPYCLNNHCIPKFYNI-SVDMK----IVHENYNGITLQNDIALLRMSEAVEYSDY 149

  Fly   231 LHPVCMPTPGRSFKGEN------GIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKIT 289
            :.|:|:      ..||.      ..|||||..:. |..|..|....:..:....| ..::..:..
  Fly   150 VRPICL------LVGEQMQSIPMFTVTGWGETEY-GQFSRILLNATLYNMDISYC-NIKFNKQAD 206

  Fly   290 DNMLCGGYDEGGKDSCQGDSGGPL----HIVASGTREHQIA-GVVSWG-EGCAKAGYPGVYARVN 348
            .:.:|.|  ....::|:|||||||    |.   |.|..... |:||:| |.|| |...|||..|:
  Fly   207 RSQICAG--SHTSNTCKGDSGGPLSSKFHY---GNRLLSFQYGLVSYGSERCA-ANVAGVYTNVS 265

  Fly   349 RYGTWIKN 356
            .:..||.|
  Fly   266 YHREWIFN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 76/253 (30%)
Tryp_SPc 127..356 CDD:238113 78/254 (31%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 76/252 (30%)
Tryp_SPc 42..271 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.