DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG30288

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:122/266 - (45%) Gaps:49/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SDCVCGIAN-IQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCV---YGFRK 174
            :||....:| .:.||.||::..:...||:..::..|:..|..||:..:|:|||.||:   |    
  Fly    29 NDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCISPMY---- 89

  Fly   175 ERISVRLLEHDRK-------------MSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVE 226
              ::|||.|:|.:             .::...:|||:  |.::|.|       ||.::::...|.
  Fly    90 --MNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKI--VHSNPGY-------DIGLLRMQRSVI 143

  Fly   227 FNEVLHPVCMPTPGRSFKGENGIV-----TGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGN 286
            |:..:.|:|: ..|::..|....:     ||||. ...|...|.||...:..|.|..|  .|.|.
  Fly   144 FSNYVRPICL-ILGKTLGGNPLSILRFNFTGWGT-NSDGEEQDRLQTATLQQLPQWSC--ERPGR 204

  Fly   287 KITDNMLC-GGYDEGGKDSCQGDSGGPLHIVASGTREHQI--AGVVSWGEGCAKAGYPGVYARVN 348
            .:..:.:| |.|.   .|||:|||||||..:.:...:.::  .||.|  :|.......|:|..|.
  Fly   205 PLDISYICAGSYI---SDSCKGDSGGPLSAIRTFEGQGRVFQFGVAS--QGLRLCSGLGIYTNVT 264

  Fly   349 RYGTWI 354
            .:..||
  Fly   265 HFTDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 69/251 (27%)
Tryp_SPc 127..356 CDD:238113 70/252 (28%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 69/251 (27%)
Tryp_SPc 45..270 CDD:238113 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.