DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG30287

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:262 Identity:67/262 - (25%)
Similarity:118/262 - (45%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKMSH 190
            |::.|:..::...||:.:::..|...|..||:..:::|||:|| ....|.:::|||.::|..   
  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC-KSETKSQLTVRLGDYDVN--- 101

  Fly   191 MQKIDRKVAEVITHPK-------YNARNY----DNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFK 244
             |.:|......|..|:       |...:|    .||||:::|:..|::.:.:..:|:.....::.
  Fly   102 -QAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWS 165

  Fly   245 G---ENGI---VTGWGALKVGGPTSDTLQEVQVPILSQ--------DECRKSRYGNKITDNMLCG 295
            .   :|.:   .||||.         |...:..|:|.|        ..|.:. :|.::..:.:|.
  Fly   166 SNILKNLVKFNTTGWGR---------TESRINSPVLQQASLTHHHLSYCAQV-FGKQLDKSHICV 220

  Fly   296 GYDEGGKDSCQGDSGGPL--HIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLT 358
            ....|  .:|||||||||  .:.....|...:.||||:  |......|.||..|..:..||:..|
  Fly   221 ASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSY--GAVHCFGPTVYTNVIHFANWIELHT 281

  Fly   359 KQ 360
            |:
  Fly   282 KK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 63/254 (25%)
Tryp_SPc 127..356 CDD:238113 64/255 (25%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 63/254 (25%)
Tryp_SPc 42..280 CDD:238113 64/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.