DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG30082

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:277 Identity:84/277 - (30%)
Similarity:127/277 - (45%) Gaps:54/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 TLN-PPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCV 169
            |:| ||.|             |||||:..::...||:|.|.......|..:|:..:|:|||:||:
  Fly    31 TINLPPTN-------------RIVGGRTADIGSNPWLAYLHKNSSLVCTGTLITKRFVLTAAHCL 82

  Fly   170 YGFRKERISVRLLEHDRKMSHMQKIDRKVAEVI-THPKYNARN------------YDNDIAIIKL 221
            :.|  ..::|||.|:|..    .:||......| |:.:|:..|            ..|||.::||
  Fly    83 HSF--HLLTVRLGEYDTS----TRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKL 141

  Fly   222 DEPVEFNEVLHPVCM-PTPGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKS--- 282
            :..|.:...:.|:|: ..||:..........|||.:.:.. |:..||.|.:..|.|.:|.:|   
  Fly   142 NGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLIN-TATVLQTVNLIRLDQSDCERSLRT 205

  Fly   283 --RYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASG---TREHQIAGVVSWGEGCAKAGYPG 342
              .||      ..|.|  :...|:|.|||||||....|.   ||..|: |:||:|....:.  ||
  Fly   206 SLSYG------QFCAG--QWRADTCSGDSGGPLSRKMSNGRITRTVQL-GIVSYGHYLCRG--PG 259

  Fly   343 VYARVNRYGTWIKNLTK 359
            ||..|..:..||.::|:
  Fly   260 VYTYVPSFTNWILSITR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 76/249 (31%)
Tryp_SPc 127..356 CDD:238113 77/250 (31%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 76/249 (31%)
Tryp_SPc 40..274 CDD:238113 77/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.