DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tmprss11e

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_766468.1 Gene:Tmprss11e / 243084 MGIID:3513175 Length:423 Species:Mus musculus


Alignment Length:276 Identity:99/276 - (35%)
Similarity:145/276 - (52%) Gaps:26/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PPTLNPPR------------NCSDCVCGI----ANIQK--RIVGGQETEVHQYPWVAMLLYGGRF 150
            ||.::|..            |..:..||.    :.:|.  |||||...|..::||.:.|.:.|..
Mouse   151 PPNVDPESVKIKKINKTESDNYFNHCCGTRRNKSTVQTSVRIVGGTPVEEEEWPWQSSLRWDGSH 215

  Fly   151 YCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDND 215
            .|.|:|:|:.:|:||:||   ||..:...|...........:|:...:..:|.|.||...::|.|
Mouse   216 RCGATLINNTWLVTAAHC---FRTHKDPSRWSATFGATLQPRKLTTGIRRIIVHEKYKYPSHDYD 277

  Fly   216 IAIIKLDEPVEFNEVLHPVCMPTPGRSFK-GENGIVTGWGALKVGGPTSDTLQEVQVPILSQDEC 279
            ||:.:|.:||.....:|.||:|.....|: |:...|||:||||..|.|.:.|::|||..:....|
Mouse   278 IALAELSKPVPCTNAVHKVCLPDANHEFQPGQRMFVTGFGALKNDGFTQNNLRQVQVDYIDTQTC 342

  Fly   280 RKSR-YGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTRE-HQIAGVVSWGEGCAKAGYPG 342
            .:.: |...||..|||.|:.:|.||:|||||||||  |.:..|: ..:|||||||:.|.:...||
Mouse   343 NQPQSYNGAITPRMLCAGFLKGEKDACQGDSGGPL--VTADVRDIWYLAGVVSWGDECGQPNKPG 405

  Fly   343 VYARVNRYGTWIKNLT 358
            ||.||..:..||.:.|
Mouse   406 VYTRVTAFRHWIASNT 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 89/230 (39%)
Tryp_SPc 127..356 CDD:238113 90/231 (39%)
Tmprss11eNP_766468.1 SEA 50..145 CDD:279699
Tryp_SPc 191..417 CDD:214473 89/230 (39%)
Tryp_SPc 192..420 CDD:238113 90/232 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.