DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tmprss11d

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:305 Identity:95/305 - (31%)
Similarity:145/305 - (47%) Gaps:36/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ATLATLSSSSMMPDAASTTSTT-TPAPSSSTTTTRRATTPAPPTLNPPRNCSDCVCGIANIQKRI 127
            :.|..||||..:..|.|...|: |...:.:..|......|...||:               ::||
Mouse   137 SVLRRLSSSGNLEIAPSNEITSLTDQDTENVLTQECGARPDLITLS---------------EERI 186

  Fly   128 VGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKER-------ISVRLLEHD 185
            :||.:.|...:||...|......:|..:|:::.::|||:||...:...:       :|.      
Mouse   187 IGGMQAEPGDWPWQVSLQLNNVHHCGGALISNMWVLTAAHCFKSYPNPQYWTATFGVST------ 245

  Fly   186 RKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRS-FKGENGI 249
              ||...::  :|..::.|..|::...|||||:::||..|.|:..:|.||:|...:: ..|....
Mouse   246 --MSPRLRV--RVRAILAHDGYSSVTRDNDIAVVQLDRSVAFSRNIHRVCLPAATQNIIPGSVAY 306

  Fly   250 VTGWGALKVGGPTSDTLQEVQVPILSQDECR-KSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPL 313
            |||||:|..||.....|::.:|.|:|.:||. .:.|...:...|||.|...|..|:|||||||||
Mouse   307 VTGWGSLTYGGNAVTNLRQGEVRIISSEECNTPAGYSGSVLPGMLCAGMRSGAVDACQGDSGGPL 371

  Fly   314 HIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLT 358
             :.....|...:.|:||||..|.....||||.||..|..||:..|
Mouse   372 -VQEDSRRLWFVVGIVSWGYQCGLPNKPGVYTRVTAYRNWIRQQT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 79/236 (33%)
Tryp_SPc 127..356 CDD:238113 80/237 (34%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:279699 0/2 (0%)
Tryp_SPc 185..411 CDD:214473 79/236 (33%)
Tryp_SPc 186..414 CDD:238113 80/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.