DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss27

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:279 Identity:93/279 - (33%)
Similarity:139/279 - (49%) Gaps:36/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RATTPAPPTLNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFL 162
            |:.|....||.        .||...:..|:|||:.....::||...:...|..:|..||:...::
Mouse    17 RSGTEGARTLR--------ACGHPKMFNRMVGGENALEGEWPWQVSIQRNGIHFCGGSLIAPTWV 73

  Fly   163 LTASHC--------VYGFRKERISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAII 219
            |||:||        :|     ::.:..|:..:...|...:  .|.:|.::|:|.......|:|::
Mouse    74 LTAAHCFSNTSDISIY-----QVLLGALKLQQPGPHALYV--PVKQVKSNPQYQGMASSADVALV 131

  Fly   220 KLDEPVEFNEVLHPVCMPTPGRSFK-GENGIVTGWGALKVGG--PTSDTLQEVQVPILSQDECR- 280
            :|..||.|...:.|||:|.|...|: |.|..|||||:.....  |....||::.|||:...:|. 
Mouse   132 ELQGPVTFTNYILPVCLPDPSVIFESGMNCWVTGWGSPSEQDRLPNPRVLQKLAVPIIDTPKCNL 196

  Fly   281 ------KSRYGNK-ITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKA 338
                  :|.:..| |.|:|||.|:.||.||:|:|||||||  |....:....|||:|||||||:.
Mouse   197 LYNKDVESDFQLKTIKDDMLCAGFAEGKKDACKGDSGGPL--VCLVDQSWVQAGVISWGEGCARR 259

  Fly   339 GYPGVYARVNRYGTWIKNL 357
            ..||||.||..:..||..:
Mouse   260 NRPGVYIRVTSHHKWIHQI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 85/246 (35%)
Tryp_SPc 127..356 CDD:238113 86/247 (35%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 85/246 (35%)
Tryp_SPc 39..278 CDD:238113 86/247 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.