DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and try-1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:271 Identity:104/271 - (38%)
Similarity:137/271 - (50%) Gaps:40/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 TRRATTPAPPTLNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYG-GRFYCAASLLND 159
            ||.|..||           |.|    .:..|::||.|:..|.:||...||.. |...|..||::.
 Worm    42 TRSAQEPA-----------DYV----TLDHRLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDP 91

  Fly   160 QFLLTASHCVYGFRKER----ISVRLLEHDRKMSHMQKIDRKVAEVITHPKYN---ARNYDNDIA 217
            .|:|||:||   |.|:|    .|||:..| |..|..   ..:|..|..||.||   ..:|  |.|
 Worm    92 NFVLTAAHC---FAKDRRPTSYSVRVGGH-RSGSGS---PHRVTAVSIHPWYNIGFPSSY--DFA 147

  Fly   218 IIKLDEPVEFNEVLHPVCMPT-PGRSFKGENGIVTGWGALKVGGPTS-DTLQEVQVPILSQDECR 280
            |:::..||..:....|:|:|: |  :.:....:|||||:...|...| .||:|:.||:||...|.
 Worm   148 IMRIHPPVNTSTTARPICLPSLP--AVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCS 210

  Fly   281 K-SRYGNKI-TDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGV 343
            . ..|..:| ..:|||.||..|..|||||||||||.....|  ..::.||||||.|||:.|.|||
 Worm   211 SLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCARDG--HWELTGVVSWGIGCARPGMPGV 273

  Fly   344 YARVNRYGTWI 354
            |..|:...|||
 Worm   274 YGNVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 95/239 (40%)
Tryp_SPc 127..356 CDD:238113 96/240 (40%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 96/239 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.