DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tpsb2

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:255 Identity:90/255 - (35%)
Similarity:128/255 - (50%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ANIQKRIVGGQETEVHQYPWVAMLLYGGRF---YCAASLLNDQFLLTASHCVYGFRKE----RIS 178
            ||.:..||||.|....::||...|.:...:   :|..||::.|::|||:|||....|.    |:.
Mouse    26 ANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQ 90

  Fly   179 VR---LLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPG 240
            :|   |...|:.:|        :..::.||.|.......|:|:::|:.||..:..|||:.:|...
Mouse    91 LREQYLYYGDQLLS--------LNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISLPPAS 147

  Fly   241 RSF-KGENGIVTGWGALKVGGPTSD--TLQEVQVPILSQDECRKSRYGNKIT--------DNMLC 294
            .:| .|.:..|||||.:....|...  .|::|:|||:....|.:..:....|        |.|||
Mouse   148 ETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLC 212

  Fly   295 GGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            .|...  :|||||||||||.....||...  |||||||||||:...||:|.||..|..||
Mouse   213 AGNTR--RDSCQGDSGGPLVCKVKGTWLQ--AGVVSWGEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 86/248 (35%)
Tryp_SPc 127..356 CDD:238113 88/249 (35%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 88/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.