DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Masp1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_036015702.1 Gene:Masp1 / 17174 MGIID:88492 Length:746 Species:Mus musculus


Alignment Length:310 Identity:94/310 - (30%)
Similarity:151/310 - (48%) Gaps:32/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 STTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSDCVCGIANIQK----RIVGGQETEVHQYPW 140
            :||...|  .|:..|.|......:.||..|       |||:....:    ||..|:..:....||
Mouse   412 NTTGVYT--CSAHGTWTNEVLKRSLPTCLP-------VCGVPKFSRKQISRIFNGRPAQKGTMPW 467

  Fly   141 VAMLLY-GGRFYCAASLLNDQFLLTASHCV--------------YGFRKERISVRLLEHDRKMSH 190
            :|||.: .|:.:|..|||...::|||:||:              |........:.:.:|.|:.|.
Mouse   468 IAMLSHLNGQPFCGGSLLGSNWVLTAAHCLHQSLDPEEPTLHSSYLLSPSDFKIIMGKHWRRRSD 532

  Fly   191 MQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWGA 255
            ..:....|.....||.||...::||:.:::|.|....|:.:.|||:|.. .|.:|...||:|||.
Mouse   533 EDEQHLHVKRTTLHPLYNPSTFENDLGLVELSESPRLNDFVMPVCLPEQ-PSTEGTMVIVSGWGK 596

  Fly   256 LKVGGPTSDTLQEVQVPILSQDECRK--SRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVAS 318
             :......:.|.|:::||::.|.|::  :....|:|.:|:|.|..|||||:|.||||||:....:
Mouse   597 -QFLQRFPENLMEIEIPIVNSDTCQEAYTPLKKKVTKDMICAGEKEGGKDACAGDSGGPMVTKDA 660

  Fly   319 GTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQACLCQQET 368
            ...:..:.|||||||.|.|....|||:.:.....||:.:|..:...|:::
Mouse   661 ERDQWYLVGVVSWGEDCGKKDRYGVYSYIYPNKDWIQRITGHSIPLQKKS 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 78/244 (32%)
Tryp_SPc 127..356 CDD:238113 79/245 (32%)
Masp1XP_036015702.1 CUB 33..142 CDD:238001
FXa_inhibition 158..186 CDD:405372
CUB 190..299 CDD:395345
PHA02639 <305..>438 CDD:165022 8/27 (30%)
CCP 306..368 CDD:153056
Tryp_SPc 454..699 CDD:238113 79/246 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6905
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.