DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and TMPRSS6

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:296 Identity:100/296 - (33%)
Similarity:154/296 - (52%) Gaps:51/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PAPPTLNPPRNCSD------CVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQ 160
            |.|.....| :|.|      |.||:.....|||||..:...::||.|.|...||..|..:|:.|:
Human   538 PNPQCDGRP-DCRDGSDEEHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADR 601

  Fly   161 FLLTASHCVYGFRKERISVRLL---------EHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDI 216
            :::||:||   |:::.::..:|         ::.|...   ::..||:.::.||.:...::|.|:
Human   602 WVITAAHC---FQEDSMASTVLWTVFLGKVWQNSRWPG---EVSFKVSRLLLHPYHEEDSHDYDV 660

  Fly   217 AIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGI---VTGWGALKVGG------------------ 260
            |:::||.||..:..:.|||:  |.||...|.|:   :||||||:.|.                  
Human   661 ALLQLDHPVVRSAAVRPVCL--PARSHFFEPGLHCWITGWGALREGALRADAVALFYGWRNQGSE 723

  Fly   261 ----PTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTR 321
                |.|:.||:|.|.::.||.|.:. |..::|..|||.||.:|.||:|||||||||...|...|
Human   724 TCCCPISNALQKVDVQLIPQDLCSEV-YRYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSGR 787

  Fly   322 EHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNL 357
            .. :||:||||.||.:..|.|||.|:....:||:.:
Human   788 WF-LAGLVSWGLGCGRPNYFGVYTRITGVISWIQQV 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 90/261 (34%)
Tryp_SPc 127..356 CDD:238113 91/262 (35%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486 5/19 (26%)
Tryp_SPc 568..822 CDD:238113 91/263 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40976
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8078
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.