DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tmprss2

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_008766769.1 Gene:Tmprss2 / 156435 RGDID:620766 Length:580 Species:Rattus norvegicus


Alignment Length:312 Identity:105/312 - (33%)
Similarity:150/312 - (48%) Gaps:52/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SSSMMPDAASTTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSD-------CV-CGIANI--QK 125
            ||..:||.:..||......|:......:       .|....:||.       |: ||:.::  |.
  Rat   195 SSQGIPDQSGATSFMKLNVSAGNVDLYK-------KLYHSDSCSSRMVVSLRCIECGVRSVRRQS 252

  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCV-------------YGFRKERI 177
            |||||.......:||...|...|...|..|::..::::||:|||             .|..|:.:
  Rat   253 RIVGGSTASPGDWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILKQSL 317

  Fly   178 SVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRS 242
            ......|            :|.:||:||.|:::..:||||::||..|:.||:|:.|||:|.||..
  Rat   318 MFYGSRH------------QVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDVVKPVCLPNPGMM 370

  Fly   243 FK-GENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECR-KSRYGNKITDNMLCGGYDEGGKDSC 305
            .. .:...::||||....|.|||.|....||::...:|. |..|.|.||..|:|.|:.:|..|||
  Rat   371 LDLAQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSC 435

  Fly   306 QGDSGGPLHIVASGTREHQI---AGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            ||||||||     .|.:::|   .|..|||.|||||..||||..|..:..||
  Rat   436 QGDSGGPL-----VTLKNEIWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 89/245 (36%)
Tryp_SPc 127..356 CDD:238113 90/246 (37%)
Tmprss2XP_008766769.1 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:292133 13/58 (22%)
Tryp_SPc 253..482 CDD:214473 89/245 (36%)
Tryp_SPc 254..485 CDD:238113 90/246 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.