DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tmprss3

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:250 Identity:95/250 - (38%)
Similarity:134/250 - (53%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 CSDCVCGI-ANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGF---R 173
            ||  .||. .....|||||..:.:.|:||...|.:.|...|..|::...:::||:||||..   :
Mouse   226 CS--ACGTRTGYSPRIVGGNMSSLTQWPWQVSLQFQGYHLCGGSIITPLWIVTAAHCVYDLYHPK 288

  Fly   174 KERISVRL--LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCM 236
            ...:.|.|  |......||:      |.::|.|.||..:...||||::||.||:.|:|.:.|:|:
Mouse   289 SWTVQVGLVSLMDSPVPSHL------VEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICL 347

  Fly   237 PTPGRSF-KGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDEC-RKSRYGNKITDNMLCGGYDE 299
            |....:| .|:....:||||.:.||..|..|....||::|...| .:..||..|:.:|||.||.:
Mouse   348 PNSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLK 412

  Fly   300 GGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            ||.|||||||||||  |....|..::.|..|:|.|||:...||||.|:..:..||
Mouse   413 GGVDSCQGDSGGPL--VCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 89/234 (38%)
Tryp_SPc 127..356 CDD:238113 89/234 (38%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 4/8 (50%)
Tryp_SPc 238..465 CDD:214473 89/234 (38%)
Tryp_SPc 239..468 CDD:238113 89/234 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.