DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:370 Identity:113/370 - (30%)
Similarity:174/370 - (47%) Gaps:49/370 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QSASQDRATN--QTAASPLLKQSQNTFI------QWVLSLLPQRPGSS----------DSENATL 66
            ::|:...:||  :...:.:|...||:.|      ..|:.|||...||:          .:|..::
Human    63 ENAASQASTNLSKDIETKMLNAFQNSSIYKEYVKSEVIKLLPNANGSNVQLQLKFKFPPAEGVSM 127

  Fly    67 ATLSSSSMMPDAASTTSTTTPAPSS------STTTTRRATTPAPPTLNPPRNCSDCVCG--IAN- 122
            .|...:.:.....:..::....|:|      |...:...|          .||    ||  :|| 
Human   128 RTKIKAKLHQMLKNNMASWNAVPASIKLMEISKAASEMLT----------NNC----CGRQVANS 178

  Fly   123 --IQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHD 185
              ...:||.|:.:....:||.|.:.:.||.||.|||::.::||:|:||   |.|:..|.....:.
Human   179 IITGNKIVNGKSSLEGAWPWQASMQWKGRHYCGASLISSRWLLSAAHC---FAKKNNSKDWTVNF 240

  Fly   186 RKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF-KGENGI 249
            ..:.:...:.|||..:|.|..|::....:|||:::|.|.|.|.|.:..:|:|...... :.:|.:
Human   241 GIVVNKPYMTRKVQNIIFHENYSSPGLHDDIALVQLAEEVSFTEYIRKICLPEAKMKLSENDNVV 305

  Fly   250 VTGWGALKVGGPTSDTLQEVQVPILSQDECRKS-RYGNKITDNMLCGGYDEGGKDSCQGDSGGPL 313
            |||||.|.:.|.....|||..:.|:....|..| .|...:||.|||.|:..|..|:||.||||||
Human   306 VTGWGTLYMNGSFPVILQEDFLKIIDNKICNASYAYSGFVTDTMLCAGFMSGEADACQNDSGGPL 370

  Fly   314 HIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLT 358
            ....|....| :.|:||||:||.|...||||.||..|..||.:.|
Human   371 AYPDSRNIWH-LVGIVSWGDGCGKKNKPGVYTRVTSYRNWITSKT 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 85/229 (37%)
Tryp_SPc 127..356 CDD:238113 87/230 (38%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699 15/79 (19%)
Tryp_SPc 184..410 CDD:214473 85/229 (37%)
Tryp_SPc 185..413 CDD:238113 87/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41415
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.