DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and CG43335

DIOPT Version :10

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:36 Identity:11/36 - (30%)
Similarity:17/36 - (47%) Gaps:12/36 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 VDPVALQFIIDAFRNQVY------------SLSTHP 580
            :||:...|:|..||..|:            ||::||
  Fly   294 LDPMIAIFLIKDFRYFVFCRSESSYVSSALSLTSHP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 127..356 CDD:238113
CG43335NP_001247121.1 Tryp_SPc 42..275 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.