DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss29

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:295 Identity:94/295 - (31%)
Similarity:134/295 - (45%) Gaps:79/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 ATTPAPPTLNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPW-VAMLLYGGRFY-------CAAS 155
            |.||||              |...:...||||......::|| |::.:|  |:|       |..|
Mouse    17 AGTPAP--------------GPEGVLMGIVGGHSAPQGKWPWQVSLRIY--RYYWAFWVHNCGGS 65

  Fly   156 LLNDQFLLTASHCV-------------------YGFRKERISVRLLEHDRKMSHMQKIDRKVAEV 201
            :::.|::|||:||:                   || .||.:|                   |:.|
Mouse    66 IIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYG-GKELLS-------------------VSRV 110

  Fly   202 ITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF-KGENGIVTGWGALKV--GGPTS 263
            |.||.:......:|:|:::|...|:....:.||.:|:..... |.:...||||||:..  ..|..
Mouse   111 IIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPP 175

  Fly   264 DTLQEVQVPILSQDECRK-----SRYGNK----ITDNMLCGGYDEGGKDSCQGDSGGPLHIVASG 319
            ..||:|||.|:....|.:     :|:.|:    |..:|||.|  ..|:|||.|||||||  |.:.
Mouse   176 YRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAG--NQGQDSCYGDSGGPL--VCNV 236

  Fly   320 TREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            |....:.||||||.|||...:|||||||..:..||
Mouse   237 TGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 86/266 (32%)
Tryp_SPc 127..356 CDD:238113 88/267 (33%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 88/267 (33%)
Tryp_SPc 31..271 CDD:214473 86/265 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.