DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Prss1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:237 Identity:98/237 - (41%)
Similarity:137/237 - (57%) Gaps:24/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRKM-- 188
            :||||.....:..|: .:.|..|..:|..||:|||::::|:||.    |.||.|||.||:..:  
Mouse    23 KIVGGYTCRENSVPY-QVSLNSGYHFCGGSLINDQWVVSAAHCY----KTRIQVRLGEHNINVLE 82

  Fly   189 SHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPT---PGRSFKGENGIV 250
            .:.|.||  .|::|.||.:|.:..:|||.:|||..||..|..:..|.:|:   |.    |...::
Mouse    83 GNEQFID--AAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALPSSCAPA----GTQCLI 141

  Fly   251 TGWG-ALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLH 314
            :||| .|..|....|.||.:..|:|.|.:|..| |..|||.||:|.|:.||||||||||||||  
Mouse   142 SGWGNTLSFGVSEPDLLQCLDAPLLPQADCEAS-YPGKITGNMVCAGFLEGGKDSCQGDSGGP-- 203

  Fly   315 IVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKN 356
            :|.:|    ::.|:||||.|||....||||.:|..|..||::
Mouse   204 VVCNG----ELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 96/233 (41%)
Tryp_SPc 127..356 CDD:238113 98/234 (42%)
Prss1NP_444473.1 Tryp_SPc 23..239 CDD:214473 96/233 (41%)
Tryp_SPc 24..242 CDD:238113 98/236 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.