DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and PRSS21

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:288 Identity:95/288 - (32%)
Similarity:139/288 - (48%) Gaps:42/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 APPTLNPPRNCSDCVCGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASH 167
            |.|...|        ||...|..|||||::.|:.::||...|.......|..|||:.::.|||:|
Human    26 AAPLSGP--------CGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAH 82

  Fly   168 CVYGFRKERISVRLLEHDRKMSHMQKIDRK--------------VAEVITHPKYNARNYDNDIAI 218
            |...:..      |.:....|....::...              |:.:...|:| ..|...|||:
Human    83 CFETYSD------LSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRY-LGNSPYDIAL 140

  Fly   219 IKLDEPVEFNEVLHPVCMPTPGRSFKGENGI---VTGWGALKVGG--PTSDTLQEVQVPILSQDE 278
            :||..||.:.:.:.|:|:  ...:|:.||..   |||||.:|...  |:..|||||||.|::...
Human   141 VKLSAPVTYTKHIQPICL--QASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSM 203

  Fly   279 CR----KSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAG 339
            |.    |..:...|..:|:|.|..:||||:|.|||||||....:|. .:|| ||||||.||.:..
Human   204 CNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGL-WYQI-GVVSWGVGCGRPN 266

  Fly   340 YPGVYARVNRYGTWIKNLTKQACLCQQE 367
            .||||..::.:..||:.|..|:.:.|.:
Human   267 RPGVYTNISHHFEWIQKLMAQSGMSQPD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 84/250 (34%)
Tryp_SPc 127..356 CDD:238113 85/251 (34%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 85/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.