DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and LOC101734975

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_004918402.1 Gene:LOC101734975 / 101734975 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:244 Identity:92/244 - (37%)
Similarity:125/244 - (51%) Gaps:17/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 QYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYG-FRKERISVRLLEHDRKMSHMQKIDRKVAE 200
            :.||...|...|...|..||:|:|:.::|:||..| .|.....|.|..:  ::|....|...||.
 Frog     4 EIPWQLSLRKLGLHICGGSLINNQWAISAAHCFAGPIRVSDYKVNLGAY--QLSVPSGIFVDVAA 66

  Fly   201 VITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF-KGENGIVTGWGAL--KVGGPT 262
            |..||.:.......|||:|||..||:|.:.:.|||:||....| .|.|.||:|||.:  :|..|.
 Frog    67 VYVHPTFKGAGSIGDIALIKLANPVQFTDYIIPVCIPTQNVVFPDGMNCIVSGWGTINQQVSLPY 131

  Fly   263 SDTLQEVQVPILSQDECRKSRYGNK---------ITDNMLCGGYDEGGKDSCQGDSGGPLHIVAS 318
            ..|||:|:|||:.:..|.:..:.|.         |..:|:|.||..|.:.||||||||||  |..
 Frog   132 PKTLQKVRVPIIGRASCDQMYHINNPTLPPYQSIIMWDMICAGYKAGRRGSCQGDSGGPL--VCP 194

  Fly   319 GTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQACLCQQE 367
            ......:||:||||.|||:...||||..|..|..||:.......|.|.:
 Frog   195 WNGSWLLAGIVSWGFGCAQPNKPGVYTSVPAYSAWIQEYVPSLQLTQPQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 88/229 (38%)
Tryp_SPc 127..356 CDD:238113 90/231 (39%)
LOC101734975XP_004918402.1 Tryp_SPc 2..232 CDD:238113 90/231 (39%)
Tryp_SPc 2..230 CDD:214473 88/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.