DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and tmprss2.14

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_031752402.1 Gene:tmprss2.14 / 101731505 XenbaseID:XB-GENE-22065937 Length:504 Species:Xenopus tropicalis


Alignment Length:246 Identity:82/246 - (33%)
Similarity:121/246 - (49%) Gaps:9/246 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 CV-CGIA-NIQKRIVGGQETEVHQYPWVAMLL--YGGRFY-CAASLLNDQFLLTASHCVYGFRKE 175
            |: ||:: .:..|||||.......:||...||  .|...| |..|::...:::||:|||||....
 Frog   252 CISCGLSTKVDSRIVGGTVASAGDWPWQVQLLKRVGASLYLCGGSIITQHWVVTAAHCVYGSTST 316

  Fly   176 RISVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPG 240
            ..:.::......:.........|...:.||.|::...:.|:|::||...:.|...|.|||:|..|
 Frog   317 PSAFKVFAGSLTIQSYYSAGYTVERALVHPSYSSYTQNYDVALLKLTAALVFTTNLRPVCLPNVG 381

  Fly   241 RSF-KGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSR-YGNKITDNMLCGGYDEGGKD 303
            ..: :|:...::|||....||..|..|:...||::|...|.::. ||..|:..|:|.||..||.|
 Frog   382 MPWAEGQPCWISGWGTTSNGGSISTNLKAASVPLISSATCNQAAVYGGAISPTMMCAGYLSGGTD 446

  Fly   304 SCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            :|||||||||  |........:.|..|||.||.....||||..:.....||
 Frog   447 TCQGDSGGPL--VTKTNSLWWLVGDTSWGYGCGMTNKPGVYGNLTFSLEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 77/232 (33%)
Tryp_SPc 127..356 CDD:238113 78/233 (33%)
tmprss2.14XP_031752402.1 LDLa <96..121 CDD:238060
LDLa 128..159 CDD:238060
SRCR_2 164..259 CDD:406055 3/6 (50%)
Tryp_SPc 265..497 CDD:238113 78/233 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.