DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and Tpsab1

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:257 Identity:100/257 - (38%)
Similarity:134/257 - (52%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 GIANIQKRIVGGQETEVHQYPWVAMLLYGGRF---YCAASLLNDQFLLTASHC----VYGFRKER 176
            |.|..::.||||||...:::||...|.....:   :|..||::.|::|||:||    |....|.|
Mouse    21 GPAMTREGIVGGQEAHGNKWPWQVSLRANDTYWMHFCGGSLIHPQWVLTAAHCVGPDVADPNKVR 85

  Fly   177 ISVR---LLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPT 238
            :.:|   |..||..|:        |:::||||.:.......|||::||..||..::.:|||.:|.
Mouse    86 VQLRKQYLYYHDHLMT--------VSQIITHPDFYIVQDGADIALLKLTNPVNISDYVHPVPLPP 142

  Fly   239 PGRSF-KGENGIVTGWGALK--VGGPTSDTLQEVQVPILSQDECRKSRYGNKIT--------DNM 292
            ...:| .|....|||||.:.  |..|....|:||||||:....|....:...||        |:|
Mouse   143 ASETFPSGTLCWVTGWGNIDNGVNLPPPFPLKEVQVPIIENHLCDLKYHKGLITGDNVHIVRDDM 207

  Fly   293 LCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354
            ||.|.:  |.|||||||||||......|...  |||||||||||:...||:|.||..|..||
Mouse   208 LCAGNE--GHDSCQGDSGGPLVCKVEDTWLQ--AGVVSWGEGCAQPNRPGIYTRVTYYLDWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 96/248 (39%)
Tryp_SPc 127..356 CDD:238113 98/249 (39%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 98/249 (39%)
Tryp_SPc 29..265 CDD:214473 96/247 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842969
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.