DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tpr and LOC100495333

DIOPT Version :9

Sequence 1:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_031749566.1 Gene:LOC100495333 / 100495333 -ID:- Length:313 Species:Xenopus tropicalis


Alignment Length:255 Identity:99/255 - (38%)
Similarity:132/255 - (51%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 CGIANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHC-VYGFRKERISVRL 181
            ||...|..||||||::|..::||...|...|...|..||::.|:.::|:|| ...|......|.|
 Frog    27 CGKPIIPNRIVGGQDSEPGEFPWQLSLRRNGLHICGGSLIDSQWAVSAAHCFAQPFSASEFQVNL 91

  Fly   182 LEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSF-KG 245
            ..:  ::|....|...|..:..||.:.......|||:|||..||.|.:::.|||:|||...| .|
 Frog    92 GAY--QLSVPSGILMNVDSIHIHPTFKGIGNSGDIALIKLASPVTFTDLIMPVCIPTPEVVFPNG 154

  Fly   246 ENGIVTGWGALK--VGGPTSDTLQEVQVPILSQDECRKSRYGNKITDN-------------MLCG 295
            .|..|||||.::  |..|...|||:|||||:.:..|.:..:    .||             |:|.
 Frog   155 INCTVTGWGTIRYLVNLPYPRTLQKVQVPIIERTTCDQLYH----VDNPSLPASQSLIMWDMICA 215

  Fly   296 GYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIK 355
            ||..||||:|||||||||  |........:||:||||.|||....||||..|..|..|::
 Frog   216 GYKAGGKDACQGDSGGPL--VCPWNGSWILAGIVSWGFGCAVPNRPGVYTSVPAYSAWLQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 95/244 (39%)
Tryp_SPc 127..356 CDD:238113 95/246 (39%)
LOC100495333XP_031749566.1 Tryp_SPc 36..274 CDD:238113 95/246 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.