DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and CD5

DIOPT Version :9

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_055022.2 Gene:CD5 / 921 HGNCID:1685 Length:495 Species:Homo sapiens


Alignment Length:149 Identity:43/149 - (28%)
Similarity:56/149 - (37%) Gaps:50/149 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LVHRYTKVLNKEEGAI--------------RLVGGDNEYEGNIEVLHNGKWGAVCDD-------E 89
            |.|.:.|:..::.|.:              |||||.:..||.:||....:|.|:||.       .
Human   247 LEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLR 311

  Fly    90 WDSTEADIVCR--QLGFPGMRRYTRSGFFGPARRRFWMDNLFCEGHEQELVDCHFEGWGEND--- 149
            |:.     |||  |.|.....|...:|  .|..|     .|||.  .|:|..|| |.|..|.   
Human   312 WEE-----VCREQQCGSVNSYRVLDAG--DPTSR-----GLFCP--HQKLSQCH-ELWERNSYCK 361

  Fly   150 -----CE----PGEAAGVV 159
                 |:    .|.|||.|
Human   362 KVFVTCQDPNPAGLAAGTV 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555 39/134 (29%)
SRCR 66..160 CDD:278931 35/115 (30%)
SR 193..298 CDD:214555
SRCR 198..298 CDD:278931
Lysyl_oxidase 303..503 CDD:279521
CD5NP_055022.2 SR 36..133 CDD:214555
SRCR 40..132 CDD:278931
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..155
SR 277..368 CDD:214555 33/105 (31%)
SRCR 281..367 CDD:278931 29/100 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..460
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 473..495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.