DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Loxl2 and MARCO

DIOPT Version :9

Sequence 1:	NP_523806.2	Gene:	Loxl2 / 37485	FlyBaseID:	FBgn0034660	Length:	511	Species:	Drosophila melanogaster
Sequence 2:	NP_006761.1	Gene:	MARCO / 8685	HGNCID:	6895	Length:	520	Species:	Homo sapiens

Alignment Length:	101	Identity:	39/101 - (38%)
Similarity:	55/101 - (54%)	Gaps:	5/101 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    60 AIRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARRRFW 124
            ::|:||..|  .|..||.::|.||.:|||||.:::|.:.||.||:...|...:   .|....:.|
Human   423 SVRIVGSSN--RGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYK---VGAGTGQIW 482

  Fly   125 MDNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVC 160
            :||:.|.|.|..|..|....||.:||...|.|||.|
Human   483 LDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVEC 518

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Loxl2	NP_523806.2	SR	61..161	CDD:214555	39/100 (39%)
		SRCR	66..160	CDD:278931	35/93 (38%)
		SR	193..298	CDD:214555
		SRCR	198..298	CDD:278931
		Lysyl_oxidase	303..503	CDD:279521
MARCO	NP_006761.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	142..423		39/101 (39%)
		Collagen	205..256	CDD:189968
		Collagen	244..303	CDD:189968
		Collagen	286..344	CDD:189968
		Collagen	334..393	CDD:189968
		SR	424..519	CDD:214555	39/100 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000389
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.000