DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and Scara5

DIOPT Version :9

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_083179.2 Gene:Scara5 / 71145 MGIID:1918395 Length:491 Species:Mus musculus


Alignment Length:103 Identity:46/103 - (44%)
Similarity:60/103 - (58%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARRRFWM 125
            ||||.|...::|.:||.|:.:||.||||.||..:.|:|||.|||.|:....|:..||....|.||
Mouse   389 IRLVNGSGPHQGRVEVFHDRRWGTVCDDGWDKKDGDVVCRMLGFHGVEEVYRTARFGQGTGRIWM 453

  Fly   126 DNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVCYPP 163
            |::.|:|.|..:..|.|..||..:|...|.|||.|..|
Mouse   454 DDVNCKGTESSIFHCQFSKWGVTNCGHAEDAGVTCTVP 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555 44/99 (44%)
SRCR 66..160 CDD:278931 40/93 (43%)
SR 193..298 CDD:214555
SRCR 198..298 CDD:278931
Lysyl_oxidase 303..503 CDD:279521
Scara5NP_083179.2 PRK09039 55..>249 CDD:181619
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..380
Collagen 318..373 CDD:396114
SR 389..489 CDD:214555 44/99 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6740
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.