DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and scara5

DIOPT Version :10

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001025361.2 Gene:scara5 / 564500 ZFINID:ZDB-GENE-041210-258 Length:499 Species:Danio rerio


Alignment Length:104 Identity:47/104 - (45%)
Similarity:63/104 - (60%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EEGAIRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARR 121
            |:..:|||.|...:||.:||||:.:||.||||.||..:.|:|||.|||.|.:...::|.||....
Zfish   394 EDAVVRLVNGSGPHEGRVEVLHDLRWGTVCDDVWDIKDGDVVCRMLGFRGAKEIHKTGRFGQGTG 458

  Fly   122 RFWMDNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVC 160
            ..|||::.|.|.|..:..|.|.|||:.:|...|.|||.|
Zfish   459 LIWMDDVACVGTEDSIDLCKFSGWGKTNCGHVEDAGVTC 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555 46/100 (46%)
SR 193..298 CDD:214555
Lysyl_oxidase 303..506 CDD:460102
scara5NP_001025361.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..392
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.