DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and scara5

DIOPT Version :9

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001025361.1 Gene:scara5 / 564500 ZFINID:ZDB-GENE-041210-258 Length:499 Species:Danio rerio


Alignment Length:104 Identity:47/104 - (45%)
Similarity:63/104 - (60%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EEGAIRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARR 121
            |:..:|||.|...:||.:||||:.:||.||||.||..:.|:|||.|||.|.:...::|.||....
Zfish   394 EDAVVRLVNGSGPHEGRVEVLHDLRWGTVCDDVWDIKDGDVVCRMLGFRGAKEIHKTGRFGQGTG 458

  Fly   122 RFWMDNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVC 160
            ..|||::.|.|.|..:..|.|.|||:.:|...|.|||.|
Zfish   459 LIWMDDVACVGTEDSIDLCKFSGWGKTNCGHVEDAGVTC 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555 46/100 (46%)
SRCR 66..160 CDD:278931 42/93 (45%)
SR 193..298 CDD:214555
SRCR 198..298 CDD:278931
Lysyl_oxidase 303..503 CDD:279521
scara5NP_001025361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..392
Collagen 308..371 CDD:189968
SR 398..498 CDD:214555 46/100 (46%)
SRCR 403..498 CDD:278931 43/95 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.