DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Loxl2 and lgals3bp.2

DIOPT Version :9

Sequence 1:	NP_523806.2	Gene:	Loxl2 / 37485	FlyBaseID:	FBgn0034660	Length:	511	Species:	Drosophila melanogaster
Sequence 2:	NP_001017658.1	Gene:	lgals3bp.2 / 550351	ZFINID:	ZDB-GENE-050417-143	Length:	561	Species:	Danio rerio

Alignment Length:	141	Identity:	59/141 - (41%)
Similarity:	79/141 - (56%)	Gaps:	18/141 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    20 TLLAIHMADAVVQHRSLEDARQERQRLVHRYTKVLNKEEGAIRLVGGDNEYEGNIEVLHNGKWGA 84
            |.|.||::   .|..:|.|.:              :|.:|.:|||||.:. .|.:||.|:|:||.
Zfish     8 TFLLIHVS---AQRWTLFDEQ--------------SKPKGVLRLVGGLSS-SGRVEVYHDGQWGT 54

  Fly    85 VCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARRRFWMDNLFCEGHEQELVDCHFEGWGEND 149
            ||||.||..||.:|||||||||.......|.:|......|:|::.|:|.|..|.:|.|:|||.||
Zfish    55 VCDDGWDLAEAQVVCRQLGFPGAVSVVSGGQYGEGSGPIWLDDMMCKGSESILSECSFKGWGVND 119

  Fly   150 CEPGEAAGVVC 160
            |...|.|||:|
Zfish   120 CTHKEDAGVIC 130

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Loxl2	NP_523806.2	SR	61..161	CDD:214555	50/100 (50%)
		SRCR	66..160	CDD:278931	45/93 (48%)
		SR	193..298	CDD:214555
		SRCR	198..298	CDD:278931
		Lysyl_oxidase	303..503	CDD:279521
lgals3bp.2	NP_001017658.1	SR	32..130	CDD:214555	49/98 (50%)
		SRCR	36..131	CDD:278931	47/96 (49%)
		PHA03098	183..>495	CDD:222983
		BACK	271..368	CDD:197943
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	111	1.000	Domainoid score	I6174
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.000