DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and lgals3bp.1

DIOPT Version :9

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_998038.1 Gene:lgals3bp.1 / 405809 ZFINID:ZDB-GENE-040426-2262 Length:572 Species:Danio rerio


Alignment Length:281 Identity:82/281 - (29%)
Similarity:117/281 - (41%) Gaps:90/281 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RQRLVHRYTKVLNKEEGAIRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGM 107
            |:.|..|..:::  :||.:||||.... .|.:||.|:|:||.||||.||..||.:|||||||||.
Zfish    16 RRTLFDRPKQLM--QEGRVRLVGVIPS-SGRVEVYHDGQWGTVCDDGWDLAEAQVVCRQLGFPGA 77

  Fly   108 RRYTRSGFFGPARRRFWMDNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVCYPPENALIPMAT 172
            ......|.:|....|.|:|::.|:|.|..|.:|.|:|||.:||...|.|||:|.|.:|      |
Zfish    78 VSVATGGQYGEGSGRVWLDDMNCKGSESLLSECSFKGWGVSDCTHKEDAGVICAPGKN------T 136

  Fly   173 PIIRDEDLPKYPIHSRSRLYVRLRGGRSRIEGRVEVSLDGGRWGSVCADGWSLLEANVVCRQLGL 237
            ..||                      :..::..:.:|.|                       |||
Zfish   137 TSIR----------------------QMSVDNSLGLSDD-----------------------LGL 156

  Fly   238 GYASEAFQTDFFGGFNVSRPVLSGSECYGNETELADCLHHDASQGIISCHGNRQHVAAVICDYIA 302
            .:.||       .|.:.:..|...||    |.||..|:|.                   :...|.
Zfish   157 LFDSE-------DGCDFTIAVRDLSE----EAELTFCVHR-------------------VILMIY 191

  Fly   303 PDLVVDY------LEIEQTAH 317
            |:|.:.:      ::|.||.|
Zfish   192 PELNLTHDTRNITVDISQTCH 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555 48/99 (48%)
SRCR 66..160 CDD:278931 44/93 (47%)
SR 193..298 CDD:214555 16/104 (15%)
SRCR 198..298 CDD:278931 16/99 (16%)
Lysyl_oxidase 303..503 CDD:279521 6/21 (29%)
lgals3bp.1NP_998038.1 SR 32..130 CDD:214555 48/98 (49%)
SRCR 36..131 CDD:278931 45/95 (47%)
BTB 165..255 CDD:197585 15/71 (21%)
BACK 271..368 CDD:197943
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.