Sequence 1: | NP_523806.2 | Gene: | Loxl2 / 37485 | FlyBaseID: | FBgn0034660 | Length: | 511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005567.2 | Gene: | LOXL1 / 4016 | HGNCID: | 6665 | Length: | 574 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 86/207 - (41%) |
---|---|---|---|
Similarity: | 129/207 - (62%) | Gaps: | 6/207 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 303 PDLVVDYLEIEQTAHLEDRPMLLMQCAMEENCVANEAYQIQRDDPHWRYRSRRLLKFTAAAINAG 367
Fly 368 NADFRPFKEKSQWEWHMCHMHFHSMEVFATFDIFN-LRGIKVAQGHKASFCLEDSNCLPGVAKKY 431
Fly 432 NCANYGDQGISINCSDVYLYNLDCQWVDVTDLIPGTYVLKIAINPEFKVAEMNYDNNAAICDLIY 496
Fly 497 TANFARVQNCQL 508 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Loxl2 | NP_523806.2 | SR | 61..161 | CDD:214555 | |
SRCR | 66..160 | CDD:278931 | |||
SR | 193..298 | CDD:214555 | |||
SRCR | 198..298 | CDD:278931 | |||
Lysyl_oxidase | 303..503 | CDD:279521 | 84/200 (42%) | ||
LOXL1 | NP_005567.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 62..123 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 239..374 | 3/3 (100%) | |||
Lysyl-oxidase like | 370..574 | 86/207 (42%) | |||
Lysyl_oxidase | 370..566 | CDD:279521 | 84/200 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D376277at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45817 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |