DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and LGALS3BP

DIOPT Version :9

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_005558.1 Gene:LGALS3BP / 3959 HGNCID:6564 Length:585 Species:Homo sapiens


Alignment Length:103 Identity:39/103 - (37%)
Similarity:55/103 - (53%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EGAIRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARRR 122
            :|.:||..|....:|.:|:.:.|:||.|||:.||.|:|.:|||.|||....:......||.....
Human    21 DGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGP 85

  Fly   123 FWMDNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVC 160
            ..:|.:.|.|.|..|.||...||.:::|.....|||||
Human    86 IMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVC 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555 38/100 (38%)
SRCR 66..160 CDD:278931 34/93 (37%)
SR 193..298 CDD:214555
SRCR 198..298 CDD:278931
Lysyl_oxidase 303..503 CDD:279521
LGALS3BPNP_005558.1 SR 24..124 CDD:214555 38/100 (38%)
BTB_POZ_M2BP 136..247 CDD:349613
BACK_LGALS3BP 256..329 CDD:350571
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.