DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl2 and Marco

DIOPT Version :10

Sequence 1:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001102481.1 Gene:Marco / 367391 RGDID:1589662 Length:519 Species:Rattus norvegicus


Alignment Length:100 Identity:40/100 - (40%)
Similarity:55/100 - (55%) Gaps:5/100 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARRRFWM 125
            :|:|||.:  .|..||.:|..||.:|||.||:.:|.:.||.||:...|..   |.||....:.|:
  Rat   424 VRIVGGTS--RGRAEVYYNNVWGTICDDGWDNNDATVFCRMLGYSSGRGL---GSFGGGTGKIWL 483

  Fly   126 DNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVC 160
            |::.|.|.|..|.||....||.::|...|.|||.|
  Rat   484 DDVSCLGTEATLWDCRKSSWGSHNCNHNEDAGVEC 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl2NP_523806.2 SR 61..161 CDD:214555 39/99 (39%)
SR 193..298 CDD:214555
Lysyl_oxidase 303..506 CDD:460102
MarcoNP_001102481.1 Collagen 150..199 CDD:460189
gly_rich_SclB <178..>418 CDD:468478
SR 424..518 CDD:214555 39/98 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.