DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Loxl2 and Fcrl2

DIOPT Version :9

Sequence 1:	NP_523806.2	Gene:	Loxl2 / 37485	FlyBaseID:	FBgn0034660	Length:	511	Species:	Drosophila melanogaster
Sequence 2:	NP_001101172.1	Gene:	Fcrl2 / 310694	RGDID:	1306885	Length:	509	Species:	Rattus norvegicus

Alignment Length:	109	Identity:	39/109 - (35%)
Similarity:	51/109 - (46%)	Gaps:	17/109 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    61 IRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGFPGMRRYTRSGFFGPARRRFWM 125
            :|||.|.:..||.:||..:|.||.||||.||..:..:|||:||....|....:..:.|.     :
  Rat   402 VRLVNGPHHCEGRVEVEQDGHWGTVCDDGWDMKDVAVVCRELGCGAARHTPIAALYPPV-----V 461

  Fly   126 DN--------LFCEGHEQELVDC-HFEGWGENDCEPGEAAGVVC 160
            |.        ..|.|.||.|.:| ..|.:   ||...|.||.||
  Rat   462 DEALPVLIQVALCNGTEQTLAECDQVEAF---DCGHDEDAGAVC 502

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Loxl2	NP_523806.2	SR	61..161	CDD:214555	39/109 (36%)
		SRCR	66..160	CDD:278931	34/102 (33%)
		SR	193..298	CDD:214555
		SRCR	198..298	CDD:278931
		Lysyl_oxidase	303..503	CDD:279521
Fcrl2	NP_001101172.1	Ig	19..85	CDD:416386
		Ig strand A	19..23	CDD:409353
		Ig strand B	33..40	CDD:409353
		Ig strand C	47..53	CDD:409353
		Ig strand C'	56..61	CDD:409353
		Ig strand E	65..69	CDD:409353
		Ig strand F	79..84	CDD:409353
		Ig_3	122..181	CDD:404760
		Ig strand B	126..132	CDD:409353
		Ig strand C	142..151	CDD:409353
		Ig strand C'	153..155	CDD:409353
		Ig strand E	162..167	CDD:409353
		Ig strand F	175..180	CDD:409353
		IG	224..304	CDD:214652
		Ig	322..395	CDD:416386
		Ig strand B	324..332	CDD:409353
		Ig strand C	340..345	CDD:409353
		Ig strand C'	347..349	CDD:409353
		Ig strand D	362..366	CDD:409353
		Ig strand F	373..379	CDD:409353
		Ig strand G	386..395	CDD:409353
		SR	402..502	CDD:214555	37/107 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	1	1.000